Ants, Bees, Genomes & Evolution

@ Queen Mary University London

Comprendre BLAST

Les fourmis sont parmis les especes les plus repandues sur terre; leur succes lie a des manieres d'organiser la vie en societe dont la complexite est proche des notres. Deux formes sociales coexistent chez la fourmi de feu Solenopsis invicta: la forme monogyne (avec une seule reine), et la forme polygyne (avec jusqu'a une centaine de reines). Lorsqu'une nouvelle reine tente de s'introduire au sein d'une colonie etablie, elle est parfois acceptee, parfois executee par les ouvrieres. L'equipe du professeur Keller de l'UNIL a montre que le choix des reines et de leur nombre depend des alleles d'un seul gene au sein des ouvrieres.

Ce gene s'apelle Gp-9 et servira d'objet d'etude pour ce TP:

>gi|17981782 Gp-9 spliced coding sequence
ATGAAGACGTTCGTATTGCATATTTTTATTTTTGCTCTCGTGGCTTTCGCTTCTGCATCTCGTGATAGCG
CGAGGAAGATAGGATCCCAATATGACAATTACGCGACTTGCTTAGCCGAACATAGTCTAACAGAGGATGA
CATCTTCTCGATTGGTGAAGTATCAAGTGGCCAGCACAAAACCAATCATGAAGATACCGAACTACACAAA
AATGGTTGCGTCATGCAATGTTTGTTAGAAAAAGATGGACTGATGTCTGGAGCTGATTATGATGAAGAGA
AAATGCGTGAGGACTATATCAAGGAAACAGGTGCTCAACCAGGAGATCAAAGGATAGAAGCTCTGAATGC
CTGCATGCAAGAAACAAAAGACATGGAGGATAAATGTGACAAAAGCTTGCTCCTTGTAGCATGTGTCTTA
GCAGCTGAAGCTGTGCTCGCCGATTCTAACGAAGGAGCATAA

Comprendre un alignement

Pour essayer de comprendre le fonctionnement de ce gene on a effectue un BLASTN. Voici un extrait de l'alignement obtenu avec l'une des sequences retournees par BLAST:

Gp-9   613   CGTATATAAATTTTAAAATCTAAGGAAAATTGTTTTATTTTAATTATATCTAAAAAATTG  672
                ||||  ||| || | |        |||  ||||  ||||||||||||||||||||||
Sbjct  1246  ATAATATTTATTATATAGT--------AAT--TTTTCCTTTAATTATATCTAAAAAATTG  1295
A quoi correspondent les barres | ? Et les - ?

Score et E-value d'un alignement

Pour determiner le degre de similarite de deux sequences, BLAST calcule le bitscore de l'alignement. Dans BLASTN, chaque identite vaut +1, et chaque difference vaut -3. Insertions et deletions n'affectent pas le score.

Calculez le score de l'alignement ci-dessus.

BLAST convertit ensuite le score de votre alignement en bitscore "standardise", puis en E-value. Vous trouverez les formules correspondantes dans votre cours. Pour les calculs on prendra: n = la taille de Genbank Nucleotide soit 89*10e9 nucleotides, K = 0.63 et lambda = 1.61

Calculez le bitscore correspondant a votre score.
Calculez la E-value correspondant a votre score.

Comparaison avec d'autres resulats

La recherche BLAST a aussi donne d'autres resultats, resumes dans le tableau ci-dessous.

scores Comparez les valeurs calculees a celles du tableau.
Qu'est-ce qui pourrait expliquer pourquoi la E-value que vous avez calculee est aussi grande?

Limitation de BLAST

Il existe diverses variantes de BLAST. Grace a une autre recherche par BLASTP, vous savez que la sequence Gp-9 est apparentee a K2000. Mais a votre grand desarroi, celle-ci n'avait pas ete trouvee par BLASTN. En utilisant un autre algorithme (cf chapitre 4 du cours), vous obtenez malgre tout l'alignement des deux sequences au niveau nucleotidique:

Gp-9   1    ATGAAGACGTTCGTATTGCATATTTTTATTTTTGCTCTCGTGGCTTTCGCTTCTGCATCT  60
            ||||||||||| |||||||||| |||||||||   |||||||| |||||||||| |||||
K2000  1    ATGAAGACGTTGGTATTGCATAATTTTATTTT---TCTCGTGGATTTCGCTTCTCCATCT  57

Gp-9   61   CGTGATAGCGCGAGGAAGATAGGATCCCAATATGACAATTACGCGACTTGCTTAGCCGAA  120
            ||||| ||||||| || ||| ||||||||| |||||| |||||| ||||||||| |||||
K2000  58   CGTGAGAGCGCGAAGACGATGGGATCCCAACATGACATTTACGCCACTTGCTTACCCGAA  117

Gp-9   121  CATAGTCTAACAGAGGATGACATCTTCTCGATTGGTGAAGTATCAAGTGGCCAGCACAAA  180
            |||| ||||| || |||| || | ||||||||| ||||||||| |||||||||| |||||
K2000  118  CATAATCTAAGAGGGGATAACGTTTTCTCGATTCGTGAAGTATAAAGTGGCCAGGACAAA  177

Gp-9   181  ACCAATCATGAAGATACCGAACTACACAAAAATGGTTGCGTCATGCAATGTTTGTTAGAA  240
            |||| ||||||||| |||||||| ||||||||| || ||||||| |||||||| ||||||
K2000  178  ACCAGTCATGAAGAAACCGAACTCCACAAAAATCGTCGCGTCATACAATGTTTATTAGAA  237

Gp-9   241  AAAGATGGACTGATGTCTGGAGCTGATTATGATGAAGAGAAAATGCGTGAGGACTATATC  300
             |||||||| |||||| ||| ||| ||||||||| ||| ||||||||||  |||||||||
K2000  238  TAAGATGGAATGATGTGTGGGGCTAATTATGATGGAGAAAAAATGCGTGCTGACTATATC  297

Gp-9   301  AAGGAA------ACAGGTGCTCAACCAGGAGATCAAAGGATAGAAGCTCTGAATGCCTGC  354
            | ||||      || |||| |||||||||| |||| |||| |||| |||||||||| | |
K2000  298  AGGGAATCAGGTACCGGTGGTCAACCAGGACATCAGAGGAGAGAACCTCTGAATGCGTAC  357

Gp-9   355  ATGCAAGAAACAAAAGACATGGAGGATAAATGTGACAAAAGCTTGCTCCTTGTAGCATGT  414
            ||||||||| ||||||| ||| ||| ||||||  |||||||||   | || ||| |||||
K2000  358  ATGCAAGAATCAAAAGATATGCAGGTTAAATGGCACAAAAGCT---TTCTAGTAACATGT  414

Gp-9   415  GTCTTAGCAGCTGAAGCTGTGCTCGCCGATTCTAACGAAGGAGCATAA  462
             | |||||||| | |||||| ||||| |||||| ||||||||| ||||
K2000  415  ATTTTAGCAGCGGGAGCTGTTCTCGCGGATTCTCACGAAGGAGAATAA  462
Quel parametre de l'algorithme de BLAST pourrait etre responsable du fait que BLAST ne puisse pas trouver de similarite entre Gp-9 et K2000?

Utiliser BLAST

Le site americain du National Centre for Biotechnology Information (NCBI) regroupe de nombreux outils utilises tous les jours par plus de 1,000,000 biologistes de part le monde. L'un d'entre eux est le portail BLAST. Utilisons la sequence genomique entiere de Gp-9:

>gi|17981782|gb|AF427893.1| Gp-9 genomic sequence
TTAATAATGAAGACGTTCGTATTGCATATTTTTATTTTTGCTCTCGTGGTGAGTTCTATTTTATAATAAT
TAAATATTAGTATAAAATTTTTCTGTTTAATTTAGTAATGTATAATACAATAATGTGTTTTGCAACTTAA
TTATAAATAAATTATAAGTATTACAATGCCCTTATTGCATGTAGACATATATTATAATGTCTACACGTTT
GTTTATATTATAAGAAGATAATATTTTACGTTTATTTATACTTGTGCATGAAATAAAACTTAATTAAAAT
AAGCAAAATAAAATTCCAAATCTAGGCTTTCGCTTCTGCATCTCGTGATAGCGCGAGGAAGATAGGATCC
CAATATGACAATTACGCGACTTGCTTAGCCGAACATAGTCTAACAGAGGGTAAGTTATATTAGAGAATTT
TACACAATTTACATGTCTTCTTAATTCATAAAGTACAGAAACAGATATTTTATGTTTGATTTTGAACCAA
TACCTTTATAATAAAAGTGTATTATATATTATTTCCATATTATATACAGCTTTCTATACTGTATTAAATA
TAAAATATTTTAATTACTTATACAAGATTTTTATTAAAAATACATCCCATAACGTATATAAATTTTAAAA
TCTAAGGAAAATTGTTTTATTTTAATTATATCTAAAAAATTGTTTACATTTAAAAAATTTATAAATTTTA
TATAATTTATATTGAGATTTTAACTATGGCCGCCTCAATAAGATTATTTCACGTCTGTGTTCACACTGCA
CTCTCATGTTTGAGTTAAAATCCCAATAGTTTTTAACGTATAAGTCGTGTTTTGTAATTATTTAAGTAGA
TACAAATTTAATATTTTCTAAATTTATTTTTTAGATGACATCTTCTCGATTGGTGAAGTATCAAGTGGCC
AGCACAAAACCAATCATGAAGATACCGAACTACACAAAAATGGTTGCGTCATGCAATGTTTGTTAGAAAA
AGATGGACTGGTAAGTAGCTATTATTTTCTATAAAAAAGAGAATATTTAAAATACAAACTATTACATAAG
AAAATAAAACATTGCAAACAAAAATATAATTTTTTTCATAACGTCTTCCCATGTAGACCTATTTAACTTA
TTGTTAGAATTGATTTCAATCATTAATTTTATTAAAAAATTAATATTTTTATATACATATATTATCACAT
TATACAACATAATTTAATTCAAAAAATAGTACAAAATATCTTATCTTTATTTTAAAACGTAATCTAATGT
ATTCAAATTATTGACGTTTTTGTCTTTCTTGTAAATATTAGATGTCTGGAGCTGATTATGATGAAGAGAA
AATGCGTGAGGACTATATCAAGGAAACAGGTGCTCAACCAGGAGATCAAAGGATAGAAGCTCTGAATGCC
TGCATGCAAGAAAGTAAGTTATAAAATTAGAAAGTAAGTTATAAAATTATACGTATAAGAGTAATTCCGT
TAATTATATAAGAAATGTTAACTTTGTTTAATAAAATGTTTTATAGTATTACTTATATACATTATGGCTA
TTTAAACATTATAATAAATTTTAAAAAATATGTTATTTTTTGTAACTTAATTATTTTTTTTTCTATTTTA
GCAAAAGACATGGAGGATAAATGTGACAAAAGCTTGCTCCTTGTAGCATGTGTCTTAGCAGCTGAAGCTG
TGCTCGCCGATTCTAACGAAGGAGCATAAGAAATGCAATTAAAAACAGCTGGCATACAACCATTATATGA
AAATTTGCAACATATAGCATTTTAAATAAAGAAATAAAATTATACAGCTTTCTTTTGTATTGACATGTTA
AAATAATACTATGAATAAATTTGATTCAATAAAGCAATTTTGTTAAAAAGGAAAAAGGATCAGAATTATC
AATTTCTTCATTCTACTACTACTATTTATAATATCATCTCTAAAATCTTGATAAATAGAACAAGTAAATT
AACAAAAATGTTAATTAAGATATATGTTCTTTTTGTTTTAATTTATATTTCAGAAATATTATATTTGCAA
TATAATAAAGACACGCAATTAACAAATATACGTAAAAATTTCTATGTATCTTTAATATAATAATTATTCT
AGTTAAGTATTTTTATTAGATATAAACTTATAAAACTATTTTTCAAACTTTATCTATATGTCAATAGACA
AAATATTAGGAATGCTTTAAAGTATACATA
Quelle variante de BLAST utilise-t-on pour trouver des sequences nucleotidiques similaires?

Faites-le.

Si vous n'obtenez aucun resultat, c'est peut-etre parce que le NCBI fait par defaut un MEGABLAST qui utilise une taille de mots tres grande (25). A cause de la limitation que vous avez vu en premiere partie, MEGABLAST ne trouvera rien. Modifiez-donc le Program Selection pour choisir Somewhat similar sequences blastn).

Trouvez-vous uniquement des sequences humaines? Pourquoi?

Elargissez la recherche en utilisant la "Nucleotide collection NR" (cette base Non-Redondante est tres vaste.

Est-ce que vous trouvez des genes similaires dans d'autres organismes?
Sur?...... ok: pourquoi n'en trouve-t-on pas?

Il est possible de limiter la recherche par une "Entrez Query" lors de la soumission du BLAST. Entrez filter[all] NOT solenopsis[organism] afin que les resultats de fourmis Solenopsis ne soient pas affiches.

Que vous montre l'image en haut de la page de resultats?
Quelles sont les autres especes pour lesquelles vous trouvez des sequences similaires?

Recherche au niveau proteine

On sait que la sequence nucleotidique degenere beaucoup plus rapidement que la sequence d'acide amines.

Quelle variante de BLAST vous permettrait de comparer votre sequence a la banque de donnees de proteines?

Faites le (sans utiliser de contrainte "Entrez Query")

A quoi correspondent les 3 segments qui s'alignent dans l'image resumant les resultats?

On ne trouve comme resultat presque uniquement les proteines Gp-9 des differentes especes de fourmis Solenopsis. Les trois derniers resultats (avec tres grands E-value) ne sont pas biologiquement pertinents.

Recherche proteine-proteine

Servons-nous desormais de la sequence d'acides amines de Gp-9:

>gi|17981783|gb|AAL51119.1| Gp-9 [Solenopsis invicta]
MKTFVLHIFIFALVAFASASRDSARKIGSQYDNYATCLAEHSLTEDDIFSIGEVSSGQHKTNHEDTELHK
NGCVMQCLLEKDGLMSGADYDEEKMREDYIKETGAQPGDQRIEALNACMQETKDMEDKCDKSLLLVACVL
AAEAVLADSNEGA
Quelle variante de BLAST devez-vous utiliser pour comparer sequence d'acides amines de Gp-9 a l'ensemble des sequences d'acides amines de Genbank?

Faites-le.

Expliquez pourquoi vous trouvez des E-values beaucoup plus petites (donc significatives), ainsi qu'un plus grand nombre de resultats par BLASTP que par BLASTX.)

Regardez les alignements faibles (par exemple celui avec une proteine d'Aedes aegypti).

A quoi correspond la ligne Query?
A quoi correspond la ligne Sbjct?
A quoi correspondent les lettres de la ligne du milieu? Et les petits + ?

Quand Gp-9 avait ete identifie, la seule proteine homologue significative etait une "Odorant binding protein"... on peut essayer de s'imaginer comment un tel gene pourrait etre implique dans le choix de reines.